PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013609611.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 278aa    MW: 31657.5 Da    PI: 6.3596
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013609611.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.2e-141966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd +l ++    G g+W+ +a+  g+ R++k+c++rw +yl
   XP_013609611.1 19 KGLWSPEEDSKLMQYMISNGQGCWSDVAKNAGLQRCGKSCRLRWINYL 66
                     678*******************************************97 PP

2Myb_DNA-binding48.91.5e-1572115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E++l+++ +  lG++ W+ Ia++++ gRt++++k++w++
   XP_013609611.1  72 RGAFSPQEEDLIIRFHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 115
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.1781466IPR017930Myb domain
SuperFamilySSF466891.25E-2717113IPR009057Homeodomain-like
SMARTSM007175.9E-111868IPR001005SANT/Myb domain
PfamPF002491.5E-131966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-222073IPR009057Homeodomain-like
CDDcd001679.09E-92266No hitNo description
PROSITE profilePS5129424.44967121IPR017930Myb domain
SMARTSM007172.3E-1571119IPR001005SANT/Myb domain
PfamPF002491.6E-1472115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2574122IPR009057Homeodomain-like
CDDcd001672.09E-1074114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MRKPEVAIAA THQVKKMKKG LWSPEEDSKL MQYMISNGQG CWSDVAKNAG LQRCGKSCRL  60
RWINYLRPDL KRGAFSPQEE DLIIRFHSIL GNRWSQIAAR LPGRTDNEIK NFWNSTIKKR  120
LKKMSETSNL VNNSSSSPNA SDSSSNSSSS LEFKDIIGSF MSFQEQGFIN PSLTNIPTNN  180
NPFTTPHMFN HSFNDDFTPH ADGFCGVNTG LQGELYFPPL ECEEGDWYKA DIINQLDDVN  240
TNGAGNVPER MRMEECWDLD QLMNTEVPSF YFNFKQNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28191217108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382830.0KF738283.1 Brassica napus MYB transcription factor 46 (MYB46.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013609611.10.0PREDICTED: transcription factor MYB46
SwissprotQ9LXV21e-159MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A0D3EFY00.0A0A0D3EFY0_BRAOL; Uncharacterized protein
STRINGBra008875.1-P1e-172(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61152347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.11e-149myb domain protein 46